SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3DSM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3DSM0
Domain Number 1 Region: 108-308
Classification Level Classification E-value
Superfamily vWA-like 1.67e-65
Family Integrin A (or I) domain 0.00000184
Further Details:      
 
Domain Number 2 Region: 564-640
Classification Level Classification E-value
Superfamily Integrin beta tail domain 6.28e-18
Family Integrin beta tail domain 0.0027
Further Details:      
 
Domain Number 3 Region: 280-395
Classification Level Classification E-value
Superfamily Integrin domains 5.02e-17
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 4 Region: 22-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000455
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 5 Region: 478-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family Integrin beta EGF-like domains 0.00032
Further Details:      
 
Domain Number 6 Region: 522-562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000257
Family Integrin beta EGF-like domains 0.0092
Further Details:      
 
Weak hits

Sequence:  D3DSM0
Domain Number - Region: 400-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00257
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Domain Number - Region: 443-471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00474
Family Integrin beta EGF-like domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3DSM0
Sequence length 712
Comment (tr|D3DSM0|D3DSM0_HUMAN) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=hCG_401305 OC=Catarrhini; Hominidae; Homo.
Sequence
MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGFGSFVDKTVL
PFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGL
DAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSN
EFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIK
NAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTA
TECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYI
GKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECD
TINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCR
CNVCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPV
KGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGI
LLLVIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
Download sequence
Identical sequences D3DSM0
ENSP00000380952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]