SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3E9T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3E9T7
Domain Number 1 Region: 27-121
Classification Level Classification E-value
Superfamily E set domains 3.36e-23
Family Copper resistance protein C (CopC, PcoC) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3E9T7
Sequence length 211
Comment (tr|D3E9T7|D3E9T7_GEOS4) Copper resistance protein CopC {ECO:0000313|EMBL:ACX64744.1} KW=Complete proteome; Reference proteome OX=481743 OS=Geobacillus sp. (strain Y412MC10). GN=GYMC10_2466 OC=Paenibacillus.
Sequence
MLKHVKTSVLLTLGLLLVLVFPTATWAHSKLESSTPAADAKITESVMEVNLSFNENIDEN
LSTLKVKNAQGEAVEVSEVKVNQNTMAGTLAGPLPSGSYTVEWKIVGGDGHPVDGTYAFE
VDAPEGEAAPETSADTEEPPADTGNTPDETATADDTAADNADPSTDTNQQAENTPANDTS
EGNGSTVWIVIIVIVAVVAGYFGIKASRKRK
Download sequence
Identical sequences D3E9T7
481743.GYMC10_2466 WP_015734753.1.35877 gi|261406310|ref|YP_003242551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]