SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3EJD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D3EJD4
Domain Number - Region: 17-112
Classification Level Classification E-value
Superfamily E set domains 0.00462
Family Arrestin/Vps26-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3EJD4
Sequence length 257
Comment (tr|D3EJD4|D3EJD4_GEOS4) SpoOM family protein {ECO:0000313|EMBL:ACX63606.1} KW=Complete proteome; Reference proteome OX=481743 OS=Geobacillus sp. (strain Y412MC10). GN=GYMC10_1319 OC=Paenibacillus.
Sequence
MSFFNKMLASVGIGAAQIDTHLEKSSYYPGEEVRGIIHIKGGNVEQTVDRIYLKLMTEYT
RESDDKKYIESYTIAKVNVSSRLTLKPGDQQEIPFAFPLPLETPLTISRQPVWIHTGLDI
DNAIDPKDRDFIDVEPNEDASIVFDAVESLGFSFKIATCEYHPRLGQGVPFVQEIEFYPG
SSYAGHIKELELILYPEQEGISILVEVDRRGRGVSGWLQRSLDMDEQHSWVTLDKQDLAQ
GPSHVAQILDRVIRRSI
Download sequence
Identical sequences D3EJD4
gi|261405172|ref|YP_003241413.1| 481743.GYMC10_1319 WP_015733829.1.35877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]