SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3ENJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ENJ9
Domain Number 1 Region: 4-350
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.52e-71
Family TK-like PP module 0.01
Further Details:      
 
Domain Number 2 Region: 290-480
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.87e-62
Family TK-like Pyr module 0.011
Further Details:      
 
Domain Number 3 Region: 494-624
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.53e-37
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3ENJ9
Sequence length 636
Comment (tr|D3ENJ9|D3ENJ9_ATETH) 1-deoxyxylulose-5-phosphate synthase {ECO:0000256|HAMAP-Rule:MF_00315} KW=Complete proteome; Reference proteome OX=1453429 OS=Atelocyanobacterium thalassa (isolate ALOHA). GN=UCYN_03050 OC=Aphanothecaceae; Candidatus Atelocyanobacterium.
Sequence
MNLSDIIHPNQLHGLPVRQLEDVARQIREKHLQTIAASGGHLGPGLGVVELTVALYQTLD
LDQDKVIWDVGHQAYPHKILTGRYNNFHTLRQKNGIAGYLKRCESRFDHFGAGHASTSIS
AGLGMAIARDNKGENYKVVSIIGDGALTGGMALEAINHAGHLPNTSLMVVLNDNEMSISP
NVGAISRYLNKVRLSDPVQFISDNIEEQFKHLPFFGDSLTPEMERLREGVKRLAMPKVGA
VIEELGFKYFGPIDGHNIEELISTFKQAHKATGPVFVHVSTVKGKGYEIAEKDQVGYHAQ
SPFSLATGKAIPSNTPKPPSYSKVFAHTLTTLAQNNSKIIGITAAMATGTGLDKLQAKLP
EQYIDVGIAEQHAVTLAAGLACEGIRPLVAIYSTFLQRAYDQVLHDVAIQNLPVFFCLDR
AGIVGADGPTHQGLYDISYLRCIPNMTIMAPKDEAELQRMVVTGINHVSGPIAMRFPRGS
GVGVPLMEEGWESIPIGKGEILRHGDDILLVAYGTMVNQSLQVAEILKEHGIEATVINAR
FVKPLDIDLIAPLAKSIGKVVTLEEGCLMGGFGSAVTEALMDLDVVVPIKRIGIPDQLVD
HATPDESKAELELTSPQIAETIRKKFFNSLQPSIVK
Download sequence
Identical sequences D3ENJ9
WP_012953714.1.87152 gi|284928885|ref|YP_003421407.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]