SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3EPJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3EPJ7
Domain Number 1 Region: 7-327
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.23e-115
Family TK-like PP module 0.00000000127
Further Details:      
 
Domain Number 2 Region: 341-533
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.16e-62
Family TK-like Pyr module 0.000000558
Further Details:      
 
Domain Number 3 Region: 538-670
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.18e-41
Family Transketolase C-terminal domain-like 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3EPJ7
Sequence length 670
Comment (tr|D3EPJ7|D3EPJ7_ATETH) Transketolase {ECO:0000313|EMBL:ADB95397.1} KW=Complete proteome; Reference proteome OX=1453429 OS=Atelocyanobacterium thalassa (isolate ALOHA). GN=UCYN_07010 OC=Aphanothecaceae; Candidatus Atelocyanobacterium.
Sequence
MIAATRSLEELCINSIRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDKFMRFNPKNPKWF
NRDRFILSAGHGSMLHYALLYLTGYDSVTIDDIKEFRQWGSKTPGHPENFETDGIEVTTG
PLGQGIANGVGLALAEAHLAAKFNKPDATIVDHYTYVILGDGCNMEGVASEACSIAGHWG
LGKLIALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVENGNTDLVAIAEAIEKAKQ
VTDKPTMIKVTTTIGYGSPNRQNTAGIHGAALGAEEIALTRQNLGWEYEPFVIPENVLTH
MGKSIDRGVDHESQWNLTLNDYKAKYPLEAAEFERYMSGRLPENWTQVLPSFTPEEAGLS
TRKYSANMLNYLSPVLPELLGGSADLTHSNLTELKNSGDFQKGQYENRNVHFGVREHAMG
AICNGIALHNSGLIPYCATFLIFTDYVRASIRLSALSQAGVIWVTTHDSIGQGEDGPTHQ
PVETVMSLRAIPTLTVIRPADGNECSGAYKIAIENAQSNLPTLLVLTRQNVPNLAGTSIE
GVDKGAYTILDCDGEPDIILMGTGSEVSLCVSAAEQLSNMSKKVRVVSMPCWEKFEAQNA
AYKESVLPKAVTKRLSVEAGISLGWTKYVGTEGDTISIDSFGASAPGKVCMEKFGFTIEN
VIAKAKMLLG
Download sequence
Identical sequences D3EPJ7
WP_012954084.1.87152 gi|284929256|ref|YP_003421778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]