SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3EQ87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3EQ87
Domain Number 1 Region: 4-170,267-383
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.22e-35
Family FAD-linked reductases, N-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3EQ87
Sequence length 406
Comment (tr|D3EQ87|D3EQ87_ATETH) Geranylgeranyl reductase {ECO:0000313|EMBL:ADB95637.1} KW=Complete proteome; Reference proteome OX=1453429 OS=Atelocyanobacterium thalassa (isolate ALOHA). GN=UCYN_09570 OC=Aphanothecaceae; Candidatus Atelocyanobacterium.
Sequence
MVLRVAVVGSGPAGSSAAETLVKAGIETYLFERNLSYVKPCGGAIPLCMVDEFELPPTII
DRRVRKMKMISPSNIEVDLNLDNKDEYIGMCRREILDGFLRDRAVELGANLINGTVYQLD
TPQNSQDPYTIYYADHSNGQALGEKKTLQVDVIIGADGANSRIAKFIDAGDYNYAIAFQE
RIRLPKDKMNRYEDLAEMYVGKDVSPDFYAWIFPKYDHVAVGTGTMKNNQAMIKKLQAGI
RSRAFSRLEGGEVIKVEAHPIPEHPRPRRVVNRVALVGDAAGTVTKSSGEGIYFAAKSAR
MCAEIIVETSNSGRTIPTEDDLKLYLKRWDKQYGTTYLVLDILQHIFYRSDASREAFVEM
CADKNAQRMTFDSYLYKTVVPMNPLVQMKLTAKTIGSLLRGHALAP
Download sequence
Identical sequences D3EQ87
WP_012954324.1.87152 gi|284929496|ref|YP_003422018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]