SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3F6Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3F6Y2
Domain Number 1 Region: 90-220
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.4e-24
Family GntR ligand-binding domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 17-106
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.31e-17
Family GntR-like transcriptional regulators 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3F6Y2
Sequence length 244
Comment (tr|D3F6Y2|D3F6Y2_CONWI) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ADB52780.1} KW=Complete proteome; Reference proteome OX=469383 OS=ID131577). GN=Cwoe_4366 OC=Conexibacteraceae; Conexibacter.
Sequence
MSPQPTSPKTGVSVIARSETLAQRAYEALRQAIRTGSMEHERVYSESELAQSMGVSRTPV
REALLELSRDGLVEILPQRGFRLRSLSHAEREEIYGLRMALEGYVVERLAMRGDPQHVAA
LRQLLDGQRRVLEEDPAGFLTIDEQFHLLMPELLQLARAHQMLVTLRGAMWLTGSLALSI
GERAPHVLEEHTAIVDAIAARDPRAARRAIREHLDASLQAVELELELEANAAGGQTERSQ
PAST
Download sequence
Identical sequences D3F6Y2
gi|284045815|ref|YP_003396155.1| WP_012935831.1.44340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]