SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3F7L1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3F7L1
Domain Number 1 Region: 117-281
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000317
Family Beta-D-xylosidase C-terminal domain-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3F7L1
Sequence length 441
Comment (tr|D3F7L1|D3F7L1_CONWI) Uncharacterized protein {ECO:0000313|EMBL:ADB50873.1} KW=Complete proteome; Reference proteome OX=469383 OS=ID131577). GN=Cwoe_2450 OC=Conexibacteraceae; Conexibacter.
Sequence
MSGAAGTSGASGGAGAAGAAGTSGAAGASGTSGGAGAAGAAGTSGAAGASERAVRARPDQ
LAALGARPPARVTATFLARPRTEVARLLDQRTARACCALLLDPVGSLPFSGGKPLRWLLT
APLPTWPRDRFALELELCPLRGSPAPTLASYAVAGAPPFVLREQAPGGLVVELGGCVVET
GIQLDYAQWQRIAVTWEEDARRLRLHKDDGPARVAAEGTGRTVAPLGPPLFEALLPGDAV
VAAGGTLVVGQLQGRPGVLADLAAGRDFRGAVAEVRVWRTPPDFTAGSAREPAEDEPALF
ARWRFSALATALGEALATPSSPPALLGGFQADELRDVARLRAVGGDTRVAIATPPAIPAD
GREHTIELLLPAADADTRDAAPSLLLDGAALPSSPLGPADVLDAAHRGVRVGALDDLRAL
TLHAADGAEIARWDGSSDSVR
Download sequence
Identical sequences D3F7L1
gi|284043908|ref|YP_003394248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]