SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3FAM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3FAM1
Domain Number 1 Region: 82-226
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.91e-18
Family GntR ligand-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 17-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.07e-16
Family GntR-like transcriptional regulators 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3FAM1
Sequence length 238
Comment (tr|D3FAM1|D3FAM1_CONWI) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ADB51184.1} KW=Complete proteome; Reference proteome OX=469383 OS=ID131577). GN=Cwoe_2765 OC=Conexibacteraceae; Conexibacter.
Sequence
MSRGTGNGGEGALVERELAGEIANAIMVGEYPLGSWLRQETLATRFGTSRQPIREALRRL
EVIGMVELFPHRGARVIGPDPSSIRDAYLIRAQLESLAARLAATAISEEQLDELTEVFET
FRTEIVRDFEAEGAQPAFRDAWVAAHNRFHELILDAASNDRLSHMVRTLNVTLPRNVTTE
VIEGRAALEDNIRQHDLVLQTLRLRAEQLAAQAMEEHIRSSGTVIADWFARRRDDPPA
Download sequence
Identical sequences D3FAM1
gi|284044219|ref|YP_003394559.1| WP_012934235.1.44340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]