SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3FBL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3FBL0
Domain Number 1 Region: 91-227
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.35e-28
Family GntR ligand-binding domain-like 0.0071
Further Details:      
 
Domain Number 2 Region: 22-90
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.59e-21
Family GntR-like transcriptional regulators 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3FBL0
Sequence length 239
Comment (tr|D3FBL0|D3FBL0_CONWI) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ADB49379.1} KW=Complete proteome; Reference proteome OX=469383 OS=ID131577). GN=Cwoe_0946 OC=Conexibacteraceae; Conexibacter.
Sequence
MAGLADLSPPGGDSLRVGRVAAPLREQVVDVLREAILDFRLKPGQRLIERELIEQIGVSR
TTIREVLRQLAAEGLVTTIPQKGAVVVVPSPEEAAELYDVRLVLEAAAVERFVKNASPEH
VRALRAAVDEMERVSGDGGDDVRAVLRANDEFYEVLLAGAGNRTFHTLLSGVQARVRVLR
ASSLSQPGRPAAAVAELRGIVEAIEAGDGERAARITADHLELAERAGLQAITAAGRIDA
Download sequence
Identical sequences D3FBL0
WP_012932432.1.44340 gi|284042414|ref|YP_003392754.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]