SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3FCW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3FCW2
Domain Number 1 Region: 8-66
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.85e-21
Family GntR-like transcriptional regulators 0.0098
Further Details:      
 
Domain Number 2 Region: 177-281
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000000000011
Family GntR ligand-binding domain-like 0.0083
Further Details:      
 
Domain Number 3 Region: 101-145
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0000523
Family GntR ligand-binding domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3FCW2
Sequence length 285
Comment (tr|D3FCW2|D3FCW2_CONWI) Regulatory protein GntR HTH {ECO:0000313|EMBL:ADB51474.1} KW=Complete proteome; Reference proteome OX=469383 OS=ID131577). GN=Cwoe_3055 OC=Conexibacteraceae; Conexibacter.
Sequence
MAFHEVVRSPAYEQVAHQLREAILDGVLGPGDELPAERELCAQFGVSRTTVREALRALQA
QGLAVAAGPTAPLRVAAAETLSLGPLRTSLVHLLRLGRVPLDDLVEVRCALEAAAVAGAA
ARRDPAQLAEARAALDAMRAVGSEHAHDAAPVGGEHTRDAAHARDARIGVAAPARGEHAH
AAARDGSAPPGDVVDRFEAADVRFHLALVAASGNEAIQLMMLAVRDSISAHLHDALRALP
EPRRAIDRLVRQHEAILAAVEAGDVRDAEHLLRDHVMGFYRGISA
Download sequence
Identical sequences D3FCW2
WP_012934525.1.44340 gi|284044509|ref|YP_003394849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]