SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3FCZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3FCZ0
Domain Number 1 Region: 182-364
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 1.31e-24
Family Thiamin pyrophosphokinase, catalytic domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3FCZ0
Sequence length 415
Comment (tr|D3FCZ0|D3FCZ0_CONWI) Thiamin pyrophosphokinase catalytic region {ECO:0000313|EMBL:ADB51502.1} KW=Complete proteome; Reference proteome OX=469383 OS=ID131577). GN=Cwoe_3083 OC=Conexibacteraceae; Conexibacter.
Sequence
MAIAGALLATTAAGPSGRPRRMVVSVAVSHPTATQNGAAVHEVSGIARIGKRTKHLVKRL
RPGDIAIIDHRDLDRVSGEDLVACGIAGVVNCSPSSSGRYPNMGPLLVVQAGITLIDAPG
ADLMQTLHDGDPIVLRGGQVWRRDELMAEGELQEPERVQALTAKRRREIGEALEAFAANT
VQYMIEERDLLSGKLELPKFDTQFRDRPVLIVVRGVDHKRDIKALRAYIRDVKPVLVGVD
GGADAIIDEGFKPDMIVGDMDSATERTLRSGAELVVHAYSDGRAPGRNYLESLGLGYKIV
PAPGTSQDIAMLIAAEKGAELIVSVGSHFNLVEFLDKNRQGMASTFLTRLRVGEILVDAK
GVSRLYRPQPGLAPVLLLAATGVVALIVVILLTPALHDVADLLWLKLQVLLGIDA
Download sequence
Identical sequences D3FCZ0
WP_012934553.1.44340 gi|284044537|ref|YP_003394877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]