SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3FES1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3FES1
Domain Number 1 Region: 70-199
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.91e-25
Family GntR ligand-binding domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.77e-21
Family GntR-like transcriptional regulators 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3FES1
Sequence length 202
Comment (tr|D3FES1|D3FES1_CONWI) GntR domain protein {ECO:0000313|EMBL:ADB49745.1} KW=Complete proteome; Reference proteome OX=469383 OS=ID131577). GN=Cwoe_1316 OC=Conexibacteraceae; Conexibacter.
Sequence
MPPRNHVAERLRELLSDQDVAPGDRLPPERELAARLGVSRSSLREGLRRLSDLGIIESRQ
GSGTYLAPVDLGDLFEVRQRLEPLAARLAAERREPHDLLALEEALAEMRAARDDAAGFGE
ADVRAHTVIVEASGSLPVRVLFAAIADLLRHSRTTTAANAPLRADALREMTEIVGAIRAH
DGAAAEAAMRGHLAHVGATVPA
Download sequence
Identical sequences D3FES1
WP_012932796.1.44340 gi|284042780|ref|YP_003393120.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]