SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3GHP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3GHP8
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000000127
Family Duffy binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3GHP8
Sequence length 138
Comment (tr|D3GHP8|D3GHP8_PLAFA) Erythrocyte membrane protein {ECO:0000313|EMBL:ACZ81718.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DIGDIIRGRDLYSGNRQRKKHEEKNKKIILLKYKQNIYDIRMDDTKTLHKIKMVETLFKL
REDWWTAIATTILGRPLHDRRQALTSAFIFLRSKRDNDTWNKVHPTHTMPVLLGQGANAG
RQLHVICPHYFDYVPILR
Download sequence
Identical sequences D3GHP8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]