SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3GU52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3GU52
Domain Number 1 Region: 1-275
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.92e-82
Family Hypothetical esterase YJL068C 0.00000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3GU52
Sequence length 277
Comment (tr|D3GU52|D3GU52_ECO44) S-formylglutathione hydrolase {ECO:0000256|RuleBase:RU363068} KW=Complete proteome OX=216592 OS=Escherichia coli O44:H18 (strain 042 / EAEC). GN=EC042_0392 OC=Enterobacteriaceae; Escherichia.
Sequence
MELIEKHASFGGWQNVYRHYSPSLKCEMNVGVYLPPKAASEKLPVLYWLSGLTCNEQNFI
TKSGMQRYAAEHNIIVVAPDTSPRGSHVADADRYDLGQGAGFYLNATQAPWNEHYKMYDY
IHNELPDLVMQHFPATARKSISGHSMGGLGALVLALRNPDEYVSVSAFSPIVSPSQVPWG
QQAFTAYLGENKEACLDYDPVSLISQGQRVAEIMVDQGLSDDFYAEQLRTPNLEKICQEM
NIKTLIRYHEGYDHSYYFVSSFIGEHIAYHANKLNMR
Download sequence
Identical sequences D3GU52
WP_000419036.1.57438 WP_000419036.1.69160 gi|387605866|ref|YP_006094722.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]