SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3H9P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3H9P9
Domain Number 1 Region: 3-243
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.74e-22
Family Mycobacterial antigens 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3H9P9
Sequence length 246
Comment (tr|D3H9P9|D3H9P9_STRM6) Uncharacterized protein {ECO:0000313|EMBL:CBJ22594.1} KW=Complete proteome OX=365659 OS=Streptococcus mitis (strain B6). GN=smi_1351 OC=Streptococcus.
Sequence
MNIEHLSHWSGNLNREMYLNRYGHAGIPVVVFASSGGSHNEYYDFGMIDACASFIEEGRV
QFFTLSSVDSESWLATWKNSHDQAEMHRAYERYVIEEAIPFIKHKTGWFDGMMTTGCSMG
AYHALNFFLQHPDVFTKVIALSGVYDARFFVGDYYNDDAIYQNSPVDYIWNQNDGWFIDR
YRQAEIVLCTGLGAWEQDGLPSFYKLKEAFDQKQIPAWFAEWGHDVAHDWEWWRKQMPYF
LGNLYL
Download sequence
Identical sequences D3H9P9
YP_003446459.1.36347 gi|289168190|ref|YP_003446459.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]