SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3HIV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D3HIV7
Domain Number - Region: 238-274
Classification Level Classification E-value
Superfamily Sec7 domain 0.0209
Family Sec7 domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3HIV7
Sequence length 1044
Comment (tr|D3HIV7|D3HIV7_LEGLN) Putative coiled-coil protein {ECO:0000313|EMBL:CBJ12336.1} KW=Complete proteome; Reference proteome OX=661367 OS=Legionella longbeachae serogroup 1 (strain NSW150). GN=LLO_1953 OC=Legionellaceae; Legionella.
Sequence
MPDFVTTNGHTQIIVPLTIMPHRHQALPTLTGSPFSYEAGTVLYGHYNMEYLLPGGDILR
LIANHNQKTVQLMLFTHQPDLIQLLPGDRPSSLVANVISKIHRYCIRSASYNHPLTPIQE
QKLKLANECIGSLKKLLKKERRLNNQDHEGHETLRRKVIEIVGLCSGQNRLLATSPLISE
GYLGNVLYEAHKTAQHYSFNRVYPVSRQDQMDFSKIIKSNGGQQQKLPCLIWDSELHIGH
NNKDLDDALRVICHYYKLPPASNLIDVPANRFAQLKTFFRKLWDDGHDWINYLAMDAKPE
HKTEIQKRLDGVTLTQISPYYRFQGFPQQGYLDLKSLIYRLTNISSEPILAKDMQHAKKA
ISQHSHGSWAIIPNKELILIRLENKVVELRYFIHDKLFYPLPEGQDLYTLGQISKRHLYL
PERASLKLKAFISRIPGFFNKFYKSMHQFIVRDLQDEFFNHIHETHIPKPAKQNSDEFNE
GRVKIRNSLILALENKGLLTTGQTLEEFIKEQISKSPYIIARPKHPPSPHPYDNPMHRIL
GVIRHAAGFFIDISEQKPLIGTLAMAAYAYGGGAVLAPELLKSILTKLHLHGLIAGIEPT
QKLAQWLSHGTIPEAISASAIYWQTTVAGGNLDKFFIEAISVLKEDPGEIAIIAALALGL
GYGLTKLIPSLGEEMGDFPYTNYAALGGKGGAALYDTIMHPGDDWFLGTCKWLCKGFLTL
GKLCISPFFEGYYYGFSNGFLKGWKKSGILLKSLSKQILAASIDFSLALLTIPLVELSAL
LIHVPFRGISILFIKTLAILGNISAPGELLIAFSTREPSENLIANFRFSPLYGFTWPFGH
FSDNPFTNISINIIRALYLPPLQLAKNLAILPILDVISFSTRLFLTVLDPITRIMTFALG
SVLITIGEAWDKSFGILFSASSKGIASACNWIDNKASAVKQTALSFIENQRGQLYHWAFA
QEDLKLHSISDDAKYYCSDPRRYELIPHSNSHCLLYALLNTNNQSVFQNECHHNPSHYQE
LFSIKKSRKEKIINSKDQSISNCI
Download sequence
Identical sequences D3HIV7
gi|289165285|ref|YP_003455423.1| WP_003636835.1.28247 WP_003636835.1.35775 WP_003636835.1.41439 WP_003636835.1.55568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]