SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3HSP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D3HSP4
Domain Number - Region: 83-147
Classification Level Classification E-value
Superfamily Sec7 domain 0.0636
Family Sec7 domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3HSP4
Sequence length 173
Comment (tr|D3HSP4|D3HSP4_LEGLN) Uncharacterized protein {ECO:0000313|EMBL:CBJ11932.1} KW=Complete proteome; Reference proteome OX=661367 OS=Legionella longbeachae serogroup 1 (strain NSW150). GN=LLO_1565 OC=Legionellaceae; Legionella.
Sequence
MRFPSTFIRLTFLIFLSSAEAKEPSIYSQYIGITHHLSKSDLSVYIDQNKILKNSSKLQK
KGIIDRNLTNTEISFYDTQLAAIASIPYVTQVIKNLYDLNNKKDQIHIISYLLTTDLYGN
KIKSFCYSFNFNRQLYQKINWKNFQSNNIVKIAPDFTVSEQCKALEETSPLSI
Download sequence
Identical sequences D3HSP4
WP_003631653.1.28247 WP_003631653.1.35775 WP_003631653.1.41439 WP_003631653.1.55568 gi|289164899|ref|YP_003455037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]