SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3P9K3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3P9K3
Domain Number 1 Region: 5-164
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.43e-34
Family Glutathione peroxidase-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3P9K3
Sequence length 166
Comment (tr|D3P9K3|D3P9K3_DEFDS) Thioredoxin family protein {ECO:0000313|EMBL:BAI81393.1} KW=Complete proteome; Reference proteome OX=639282 OS=101012 / SSM1). GN=DEFDS_1942 OC=Deferribacter.
Sequence
MRIKSILAVSILVLSLLFSSCSQNQQAENTKQIVSSLETINVAQFKELKNRYKDKVILVN
FFASWCPPCNQETPGFVRVYNKLKDKGFIILAFSIDDNVDDAVKFVNKYGITYPVYHADR
SLEAYFNVSTIPTSVFYKKGGTLYNLHVGYIDEKDLENYILDLLNK
Download sequence
Identical sequences D3P9K3
gi|291280314|ref|YP_003497149.1| WP_013008638.1.2578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]