SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3P9P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3P9P2
Domain Number 1 Region: 19-168
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.83e-53
Family NQO2-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3P9P2
Sequence length 171
Comment (tr|D3P9P2|D3P9P2_DEFDS) NADH-quinone oxidoreductase, E subunit {ECO:0000313|EMBL:BAI81432.1} KW=Complete proteome; Reference proteome OX=639282 OS=101012 / SSM1). GN=DEFDS_1981 OC=Deferribacter.
Sequence
MAENIVEKKEQEEVKEELDLSAIDEICAEYKGRKGATIPVLQKVQEHYGYLSKEMVDRIA
ENLNMSPHTIYGVITFYAQFYTTPRGKYVIRVCRGTACHVKGSGRISEVVTEEFGIKNGE
TSSDLKFTLEEVSCIGACGMAPVIMINDKTYGNLTPEKAREIFREYAKKDD
Download sequence
Identical sequences D3P9P2
WP_013008677.1.2578 gi|291280353|ref|YP_003497188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]