SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3P9Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3P9Q8
Domain Number 1 Region: 32-144
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.1e-19
Family Glutathione peroxidase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3P9Q8
Sequence length 144
Comment (tr|D3P9Q8|D3P9Q8_DEFDS) Uncharacterized protein {ECO:0000313|EMBL:BAI81448.1} KW=Complete proteome; Reference proteome OX=639282 OS=101012 / SSM1). GN=DEFDS_1997 OC=Deferribacter.
Sequence
MKKYLILLLIIFIADISYSSNRLSVKEYEGIIKGEKSDVIVVFWASYCPYCKKEIKELHE
NNLFLSKKNINVILVAIDKIESSAKRAYKKLNVNYPFYLASEELVNHINARFVPITAVYN
KKGELVDIAPGYKTFDEILEMLKE
Download sequence
Identical sequences D3P9Q8
gi|291280369|ref|YP_003497204.1| WP_013008693.1.2578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]