SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3P9T4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3P9T4
Domain Number 1 Region: 21-74
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000114
Family Thioltransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3P9T4
Sequence length 80
Comment (tr|D3P9T4|D3P9T4_DEFDS) Uncharacterized protein {ECO:0000313|EMBL:BAI81474.1} KW=Complete proteome; Reference proteome OX=639282 OS=101012 / SSM1). GN=DEFDS_2024 OC=Deferribacter.
Sequence
MIKVEFFYNGSKDTNTPEIAKNLAEKYRDKIEVILIDTEKEKIPEEYGILNPPVVIIDKK
KKIQLDSKENLDEIVTKAIF
Download sequence
Identical sequences D3P9T4
gi|291280395|ref|YP_003497230.1| WP_013008719.1.2578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]