SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3PDG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3PDG3
Domain Number 1 Region: 4-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.16e-40
Family Thioltransferase 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3PDG3
Sequence length 105
Comment (tr|D3PDG3|D3PDG3_DEFDS) Thioredoxin {ECO:0000256|PIRNR:PIRNR000077} KW=Complete proteome; Reference proteome OX=639282 OS=101012 / SSM1). GN=DEFDS_1167 OC=Deferribacter.
Sequence
MALTFTEENFQKEVLESDIPVLVDFWAVWCGPCKMLAPTIDQLANELEGKVKVGKVNVDE
NQSLAARYGIMSIPTVMIFKDGKVVEQFIGVQPKGVYVDALNKYL
Download sequence
Identical sequences D3PDG3
gi|291279557|ref|YP_003496392.1| WP_013007883.1.2578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]