SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3PDY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3PDY8
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.18e-43
Family Glutathione peroxidase-like 0.0000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3PDY8
Sequence length 168
Comment (tr|D3PDY8|D3PDY8_DEFDS) Thioredoxin peroxidase {ECO:0000256|HAMAP-Rule:MF_00269} KW=Complete proteome; Reference proteome OX=639282 OS=101012 / SSM1). GN=DEFDS_1350 OC=Deferribacter.
Sequence
MERTGLITMKGNPITLVGNEVKVGDKAPDFTVLDITLSTKRLSDYKGKLKIISVTPSLDT
PVCDMQMRTFNEKASKYKDAVVLNISMDLPFAIKRFCTTAGIENVEGLSDYKDADFGQKY
GLLIKELRLLARAVLVIDKDDNIIYYELVKEVTDHPDYDKLFAFLDNL
Download sequence
Identical sequences D3PDY8
WP_013008057.1.2578 gi|291279732|ref|YP_003496567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]