SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3PEP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3PEP3
Domain Number 1 Region: 113-275
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.68e-28
Family DsbA-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3PEP3
Sequence length 290
Comment (tr|D3PEP3|D3PEP3_DEFDS) Uncharacterized protein {ECO:0000313|EMBL:BAI81685.1} KW=Complete proteome; Reference proteome OX=639282 OS=101012 / SSM1). GN=DEFDS_P061 OC=Deferribacter.
Sequence
MKKNILKIINFVMLLLFVLTSISMASGNSYSNTISQKLKKIIESKDNNIEVTVEKSIPSK
EIAGFAYVLLKIHPKGNKELSQELFVLSNGKYIIPALIDIDKDLNMLDLVKIDINKIQFN
PDKNKLELGNADAKVKIVMFSDFECPFCRQAFPFIKNLAQKYNKQVAVYHYNFPLNFHKH
ARNLAIVYEAGKELGLNLADVLYSMKLDNIKSIDDILNNLKDKIPAPKYGKLKDLVKKSN
KYNKIIESDMKVGSDLGVKGTPFFIINGSIISGFNPNLIKIAVDKYVKSK
Download sequence
Identical sequences D3PEP3
gi|291280607|ref|YP_003497441.1|NC_013940 gi|291280607|ref|YP_003497441.1| WP_013008922.1.2578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]