SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3Q1E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3Q1E6
Domain Number 1 Region: 103-233
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.62e-23
Family GntR ligand-binding domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 16-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.68e-17
Family GntR-like transcriptional regulators 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3Q1E6
Sequence length 235
Comment (tr|D3Q1E6|D3Q1E6_STANL) GntR domain protein {ECO:0000313|EMBL:ADD45726.1} KW=Complete proteome; Reference proteome OX=446470 OS=102104 / LLR-40K-21). GN=Snas_6102 OC=Stackebrandtia.
Sequence
MGTVDSTLTGARANQRALQESIKRLIVERGLTAGSPMPPERELIEELAVSRHPLREAMKA
LEALGIVDIRHGHGTYVGSVSLSGFEAGLTFHSALSARGDLGAIRDLLEVRQVLETGLAP
RVLAAYDDIDVAGLTEAVETMEAAAANDRYEPDADWRFHETIYKPLGNKLVLDLLQVFWR
VFRSLDAQLPSDEYTPAVNASWHRAILDALIRRDEPGLIAAIDDHFRGIRARVSG
Download sequence
Identical sequences D3Q1E6
gi|291303541|ref|YP_003514819.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]