SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3Q596 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3Q596
Domain Number 1 Region: 5-253
Classification Level Classification E-value
Superfamily Cgl1923-like 6.67e-78
Family Cgl1923-like 0.0000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3Q596
Sequence length 282
Comment (tr|D3Q596|D3Q596_STANL) Uncharacterized protein {ECO:0000313|EMBL:ADD44145.1} KW=Complete proteome; Reference proteome OX=446470 OS=102104 / LLR-40K-21). GN=Snas_4500 OC=Stackebrandtia.
Sequence
MTPTDGLPDLRSPVLVAAFTGWNDAADAASHVIAHLSEQWQAEHTATIDPDPYYDFQMAR
PSVKVTAEGVERVDWPYTGFSVASPTDADRDVVLLTGAEPSMHWRGFCAEVAEICHSLGV
EQVILLGSLMADVGYTRPLPVSGTTNDPALAKRMKMDPVDYEGPAGIIAVLQATFQEAGV
PVTSCWVHVPHYAATSPCPKATLGLLHRVEELLDLPVPAGGLVEQTAQWENDVTQLVEAD
SDIADYISSLDEPQAGDEPSGDDIAKDFERYLRRRGPHTDDN
Download sequence
Identical sequences D3Q596
gi|291301960|ref|YP_003513238.1| WP_013019716.1.89426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]