SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3Q936 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D3Q936
Domain Number - Region: 24-87
Classification Level Classification E-value
Superfamily Sortase 0.0381
Family Sortase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3Q936
Sequence length 215
Comment (tr|D3Q936|D3Q936_STANL) Uncharacterized protein {ECO:0000313|EMBL:ADD40645.1} KW=Complete proteome; Reference proteome OX=446470 OS=102104 / LLR-40K-21). GN=Snas_0934 OC=Stackebrandtia.
Sequence
MTTFSDQTDGTRTAAAERLSMFVDAVIAIALTLLALELPVPTGDTTDAMLRSASAHSSEY
LAFGLGFVVIAAHWRAHHEIFRHVHSLSNRLVSLTLVWLFMQVLMPFATRVITAEGALPP
RFSLYAIVQVLASASFALIIREIRREHLHRTEDPPREFAQSLVRSICLATVFALSVPVVF
LTGSTLAYLCWLAAPIVLAVASRVRRRAVKSPRTA
Download sequence
Identical sequences D3Q936
WP_013016216.1.89426 gi|291298460|ref|YP_003509738.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]