SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3R275 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3R275
Domain Number 1 Region: 223-246,273-452,579-659,698-711
Classification Level Classification E-value
Superfamily Subtilisin-like 3.14e-55
Family Subtilases 0.0012
Further Details:      
 
Domain Number 2 Region: 471-533
Classification Level Classification E-value
Superfamily PA domain 0.0000000798
Family PA domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3R275
Sequence length 1871
Comment (tr|D3R275|D3R275_MAGIU) PA domain protein {ECO:0000313|EMBL:ADC91788.1} KW=Complete proteome; Reference proteome OX=699246 OS=BVAB3 (strain UPII9-5)). GN=HMPREF0868_0979 OC=Mageeibacillus.
Sequence
MKRILMKGSAILTALCMLTLCTEWPANVKADYDSAGAVWPNMPKSTVAAEATEHMLDTFI
CRLRGCGIIKSKEDLNNFGGAIPITIALHNETEAAGTQLDFIHLLGRRYQRIDEFMAKIA
KQIGREPVKIRKAALTNPMVATELTLKEIKSISKNKELERIEPDFPMLTTAHGFPAKTMI
RQNYSPINLGDIGNSSILYGAMSRNSRKSIFSDRAADIAFLPKLNGTGRVVAVLDTGFDI
DHPDFAMPDLTGAKYVDRESIIRRINEINSAAGTTLIRGGWLNNKFPYGYNYANNTFDVK
ESGNSHGTHVAAIAAASAGGKFPGQAPGAQIFAMRVLAGESDYAAPSVYAKAIEDSILLG
ADSINMSFGVPAATLKHAAAEILQAIATAKKMGVMVTVSAGNSNYADADLIPPQADNPNY
GTISSPALTPDVIAVASLDNSTVMLPYLNSGAAKIPYYPSSSRSLIDVYGKSLPLYDVGE
ATKDDLKDLPAKSLAGKAALIKRGKIKFDEKVAAVATLGAELAVIYDNESSGEWVNMGIN
NPAIPAIFLRKDDGLVLRKNGGSILLNKNQAAFKLTNGGKMSYFSSWGPTPEFDLKPELT
AVGGHVQAAQPGNTYGDKSGTSMAAPQVAGVAALLRERMLKDNDLSLDVQKTGATQLQNS
VAEGKNSVAVDNASYYRFAKNMLMSTATPQVDRKNNLFVSPRKQGAGLLNKEGVLTGYAY
VTSEIGESKLNLGNMASPIFNLPLVIHNCSKTKSLKFNIAQVTVQTDSLNPAHPQMIIPE
SSRRIVPDYHNDATIVVAPKSEYKFTIPIDISSLESELAKQFINGYFVEGFVRIKSLQPE
QGDIGLPYIGFRSGARNAGGGFIDLPVLERPIYEYEDLSENSAYTPKYYKLNQAKDKNAF
TALVSELNGKKVVLGETTTVPNKVRVFDKSKIAISPNGDGCQDYAELRGVFLLAYCEDKV
EITDEKGKVVFEGKDGYSGKADSNSANVGRKNMASTSDGTDADFYTEAERYKWYGKGRYG
EELPDGKYNYTFTVRGAAEAAKPQKYTFPIVVDRNKPEIVKPTLTSNGFAAEFVESGSGI
KTVRAETYDVDGKLLQVTIPKVSGNKLELSSSQDKLASTYLRLQDFAGNETFVAVKRLLA
GNDTGSLQVITTVKPLKPGESVDPLSSDEYEIIVKDSLGQRQMDTAALPYGKYTAEIKLK
ISNFVAVNKVENFTLTPTAKHAVLNFQVREVPTVKIDIPVDVSTDNGRMPNAERPIITAV
GTDGVVEEAEVKTSFSSAGNANTANFMLAAGKWQLTARRVPAGWRMLPEKVDIEVAGDGT
LSVINGSLPFTLIGPKVLGIEPQVEVLSGKLPMEKISYKAVVVGDKGKNKFAGHVFTDLS
ALPQGEYDVYPQLPKGFFAVPDVIRVDLRSEIAKPDLRIYAETEHDFGKIEVSENIDTKP
ASSPLADYVAINTNGEKFVDLHKLPYGTWLIKPRYTPQKFYTEQSEEKVILKPESKIAKV
VFNWMSFAASNKKGSVVLNPDWGFEWNLHNTFEKSSAKPYKYLFHRLDKPEQKDMTFELS
APSYYPPYTPVASDVPYGIYKVIPDTSATPNIFATPKSQIVRVSRTKSSIAFKYGNVEPK
ENKATIMENTSLGVKVILPENSALSGLKIKLVAEELNQVPSAVQAAYDKLPVKRKIYEIH
IVDEQGKVVPVPENEVWQVEIPRFYQEANAAAYYLSPNGYPIKPEQKVDNDLISMKVEHL
SVYAVAAGDMPQPKPEPQPKPEPQPKPEPQPQPEPQPNPNPNPQPKPDQEDQQPSSHSTS
EFDLYQKFFLSNASLKDREKGRQLNTRAGALPKTGEKGEKSVAPIMLIILGVALMVDLII
RKLQQIRRERS
Download sequence
Identical sequences D3R275
gi|289450816|ref|YP_003475282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]