SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3S7V8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3S7V8
Domain Number 1 Region: 273-551
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 3.66e-144
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000000765
Further Details:      
 
Domain Number 2 Region: 4-272
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 9.42e-144
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3S7V8
Sequence length 552
Comment (tr|D3S7V8|D3S7V8_METSF) Methyl-coenzyme M reductase subunit alpha {ECO:0000256|PIRNR:PIRNR000262} KW=Complete proteome OX=644281 OS=Methanocaldococcus sp. (strain FS406-22). GN=MFS40622_0424 OC=Methanocaldococcaceae; Methanocaldococcus.
Sequence
MEVEKKLFLKALKEKFEEDPKEKYTKFYIFGGWRQSARKREFVEFAQKLIEKRGGIPFYN
PDIGVPLGQRKLMTYKISGTDVFVEGDDLHFCNNAAIQQLVDDIKRTVIVGMDTAHAVLE
KRLGVEVTPETINEYMETINHALPGGAVVQEHMVEVHPGLVWDCYAKIFTGNDELADEID
KRFLIDINKEFPEEQAEQIKKYIGNRTYQVSRVPTIVVRCCDGGTVSRWSAMQIGMSFIT
AYKLCAGEAAIADFSYAAKHADVIQMGMILPARRARGPNEPGGVPFGIFADIIQTSRVSD
DPAQVTLEVIGAAATFYDQVWLGSYMSGGVGFTQYASATYTDDILDDFVYYGLDYVEKKY
GLCGVKPSMDVVKDIATEVTLYGLEQYDEYPALLEDHFGGSQRAGVTAAAAGCSVAFATG
NSNAGINGWYLSQILHKEYHSRLGFYGYDLQDQCGAANSLSIRSDEGLLHECRGPNYPNY
AMNVGHQPEYAGIAQAPHAARGDAFCLNPIIKVAFADDNLIFDFKWPRKCIAKGALREFE
PAGERDLIIPAA
Download sequence
Identical sequences D3S7V8
gi|289191913|ref|YP_003457854.1| WP_012980029.1.35598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]