SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3S7W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3S7W0
Domain Number 1 Region: 189-443
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 8.37e-130
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000656
Further Details:      
 
Domain Number 2 Region: 3-188
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.14e-81
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3S7W0
Sequence length 447
Comment (tr|D3S7W0|D3S7W0_METSF) Coenzyme-B sulfoethylthiotransferase beta {ECO:0000256|PIRNR:PIRNR000263} KW=Complete proteome OX=644281 OS=Methanocaldococcus sp. (strain FS406-22). GN=MFS40622_0426 OC=Methanocaldococcaceae; Methanocaldococcus.
Sequence
MLHYEDKIDLYDERGKLLEENVPLEAISPLKNPTIERIVNDIKRSVAINLAGIENALRTG
AVGGKACFCPGRELDLPIVENAEIIAEKIKKMVQIEEDDDTVVKLINGGKQLLLQLPSKR
LRVAADYTVSALIGGGATVQAIVDTFEVDMFDAPVVKTAVMGRYPQTVDFHGANIATLLG
PPVLLEGLGYGLRNIMANHIVAVTRKKTLNAVALASILEQTAMFETGDALGAFERLHLLG
LAFQGLNANNLTFELVKKNGKDGTVGTVVASVVERALEDGVIRPVKTLPSGFTVYEPVDW
ALWNAYAASGLVAAVIVNVGAARAAQGVASTVLYYNDILEYETGLPSVDFGRAEGTAVGF
SFFSHSIYGGGGPGTFHGNHVVTRHSKGFAIPCAAAAMCLDAGTQMFSVERTSALVGTVY
SAIDHLREPLKYVAEGAVEVKEKEKVI
Download sequence
Identical sequences D3S7W0
WP_012980031.1.35598 gi|289191915|ref|YP_003457856.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]