SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3SSJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3SSJ7
Domain Number 1 Region: 239-314
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00000000902
Family Cna protein B-type domain 0.0041
Further Details:      
 
Domain Number 2 Region: 147-218
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000271
Family Carboxypeptidase regulatory domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3SSJ7
Sequence length 320
Comment (tr|D3SSJ7|D3SSJ7_NATMM) Cna B domain protein {ECO:0000313|EMBL:ADD06842.1} KW=Complete proteome; Reference proteome OX=547559 OS=8861/ NBRC 102185 / NCIMB 2190 / MS3) (Natronobacterium magadii). GN=Nmag_3292 OC=Natrialba.
Sequence
MSNSNRRHTTETRSIQTGVQVMLTVAGVVLLVAGLALAASGASINGALGPFGDDSDETEP
DVDEPDADGGDDDSTAGDDGGDTDETDETDDTDDADDGSESDESNDGAGDDDDGADDDDG
ADDEDDAGNGDENGGDDADDEHTLTATIEDDDGDEIENATVELTSGLSSSERTADDDGTV
EFTVDDGEYTLTASADGYEEAEADVEIDGDDEDVTLELESDEDEDEDEDDTDADDEYTLT
TLVEDDDDGDEIEDATIELYTGNQLFGPDAEATTDDDGEAELEVEEGEYTVIVTADDYEE
AEFNLEVDDDDEITVVLEED
Download sequence
Identical sequences D3SSJ7
gi|289582938|ref|YP_003481404.1| WP_012996815.1.6702 WP_012996815.1.81346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]