SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3SV39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3SV39
Domain Number 1 Region: 133-421
Classification Level Classification E-value
Superfamily Subtilisin-like 2.75e-75
Family Subtilases 0.00000433
Further Details:      
 
Weak hits

Sequence:  D3SV39
Domain Number - Region: 55-103
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00264
Family Subtilase propeptides/inhibitors 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3SV39
Sequence length 474
Comment (tr|D3SV39|D3SV39_NATMM) S8 family serine protease {ECO:0000313|EMBL:ADD05447.1} KW=Complete proteome; Reference proteome OX=547559 OS=8861/ NBRC 102185 / NCIMB 2190 / MS3) (Natronobacterium magadii). GN=Nmag_1874 OC=Natrialba.
Sequence
MTLTRRQLLQGAGAAVSVSLVTSSGTAAASQSSAGSPSSDSRRVFVHPQNGLLGELLDVV
DSVGGTTLREYDNFEFVLAEVPANRLDELLAATGVATVEEDDETGIPDDWSPSLLESLLP
PDRSDCETHPDQQASWGLERIGASEVEPNGSGVDIGILDTGIQTDHCSLSVAGGQNVTGS
GLPDDYEDRHGHGTHVAGVAGAVDNGRGVVGTAPNANLYAVKVLDDDGDGRYSDLIAGID
WCMENDVEIISMSLGGESESEAVAEAIETAHSAGHLLLSAAGNEGNNGRSSCTEETMTYP
ATHDDVVAVTAMDEDDTLAAYSSVGEGVDLLAPGTDIRSSTVDNRYAEASGTSVAAPFVA
GVAALCWETREESGTGSGSGSGSGPEPGTNDAVRSILTETAETVLDTCAEGAGLVDAREA
VGDERATGGSERSEDQSQIESGAVGTLRDGVSSAFEWVTDLVGAIVERLGRLFG
Download sequence
Identical sequences D3SV39
gi|289581543|ref|YP_003480009.1| WP_012996588.1.6702 WP_012996588.1.81346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]