SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3SZG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3SZG5
Domain Number 1 Region: 136-408
Classification Level Classification E-value
Superfamily Subtilisin-like 7.59e-78
Family Subtilases 0.00000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3SZG5
Sequence length 683
Comment (tr|D3SZG5|D3SZG5_NATMM) Serine protease halolysin {ECO:0000313|EMBL:ADD04299.1} KW=Complete proteome; Reference proteome OX=547559 OS=8861/ NBRC 102185 / NCIMB 2190 / MS3) (Natronobacterium magadii). GN=C500_16110 OC=Natrialba.
Sequence
MQPERRDTRSRRSILRGAGAVGGLIGATGLSSATPGRSPGPKQTELLVGINDEYARSSAN
GTERTAREAVPADATVVHSNEQLEYVAIEVPAELPSEAVEHVRDVLDSNDAIEYVEENAT
LQSLYTPNDPYYDSQHAPQQVNCEDAWAETLGDEDVTIAVVDQGVEYEHENLSGNVDDRI
GEVFVGRGSDPGPLSRGDTHGTLVAGIAAGETGNGTGQAGISNCSLLAARALDEQGQGAL
SDIADAIQWAADEGVDVINLSLGSSSGLWTLENACEYATERGCLVVAAAGNSGGSVMYPA
AYDDVLAVSALTSRDRLASFSNRGPEIDLAAPGQNLLSTTLNDGYDRISGTSAAAPVVAG
VAGLVRSVYPGLSSSALREHLRETAVDVGLRSAAQGAGRVDAGNAVTTVPEGYDGPDERD
GDTDEDEEDDEDDEETDTDGHLLSFVTEPEASFADYEFTATGPVEFTTAPGQTPSGGTIE
GGTYAAEDYIEEDDETWHAGGVTGGGQGDAFSVEGAITSIEVGQPDVMWVELDGERLSPE
EVIEETTGDDTDETDGGEEDESDETDETDEPQCGDETNTARVEGDLDGSGWWPDTARWQY
TPQTENPCELTLTVDGPSGADVELYMTRDGRRPTQWDADESATATGDTQSLTTALESDDT
VRILITATGGSGTYELEIVEQGY
Download sequence
Identical sequences D3SZG5
gi|289580395|ref|YP_003478861.1| WP_004216472.1.6702 WP_004216472.1.81346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]