SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3T2A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3T2A8
Domain Number 1 Region: 150-450
Classification Level Classification E-value
Superfamily Subtilisin-like 7.2e-62
Family Subtilases 0.000032
Further Details:      
 
Domain Number 2 Region: 982-1237
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.8e-24
Family Pectin methylesterase 0.067
Further Details:      
 
Domain Number 3 Region: 457-532
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000000000922
Family Carboxypeptidase regulatory domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3T2A8
Sequence length 1618
Comment (tr|D3T2A8|D3T2A8_NATMM) S8 family serine protease {ECO:0000313|EMBL:ADD07717.1} KW=Complete proteome; Reference proteome OX=547559 OS=8861/ NBRC 102185 / NCIMB 2190 / MS3) (Natronobacterium magadii). GN=Nmag_4209 OC=Natrialba.
Sequence
MGDEMGTAATDKYDFSLDESIPSSIGTDDPDQSNKGEVIIDENTFQAEGTVEVLVSAEDV
ELPIVTDVDVKTALQTTAEESQEPIVEYAESTEGVEVLNQFWITNALLLELDKDQVSATE
IAAQEGVESIDYNADIELDEPVEYDDDVNTTYGLDQINAPDVWDDHDTMGEGAEIAILDT
GVDPDHPDIDIEDENWAEFDEDGEQVDSDPYESHSNGHGTHVSGTATGGNASGEYIGVAP
EADLMHGLVLDAGSGSLAQIIGGIEWAVEEDADAVSMSLGVSAYEEAFIEPQMNALDAGT
LVIASSGNDGEGSSSSPGNDYDSFAIGATDESEDIAQFSSGEWIDTQIAWGSDAPDHWPE
EYVVPDIAAPGVGVNSAQPDGEYDTLSGTSMAAPHVAGTVGLMAAASEDDLSPEQYETAM
TAHAWQPDNDLDDPNDRFGQGILDASHSVDQVAADQGINGTITDSNGDPIEGVDVELDSG
YSVSTDENGEYTLRGTEDTFEFEASAFGYESVTETVEVSEGEFEQIDITLEDFVDAEPTT
LPTGIVSGQNNSFAFETAHLEELSVSMDGNYDEENATLYVDGQEIDFNEAWEAEEPFDEV
EIDLYAEDGTTGEMMLEFVFADGDDEFVFETDELEVFAEEIDTAVVDAPDGEFGALLASD
LDDNLDANYNITTVDSDEVVDRVDDFDTFVVQRFADSNEQDEDLVREFFEATDRADIGVV
YLDQYDESGSWSDSIHELSRATGVPGYTDQDFVGEIEPVEYEATEEHPILDGVVEEGERV
ELYDTPDHTWFGGHHGNDIADVGWKNNSASGHGLATDDARNNVYAASLGYSTLVGDVIPF
TEEAEEVLTNSVEHVSESRTATLDEDQPDRVDPGEAISAEFSVDDIDDVEITVELDDYHT
TTAEENLTLYVQETEYAFGEPIEPDEPIDPTDTRFNDAINVTVVPEDGETGIVALEHDID
VGGESVDGFTGPTSVYEPPIEVGEEGDAETIQDAVDLAIPEATIVVEDGTYKEQVVMWAD
ANHDVTIEAAEDAEPSLELPDDAVEMPAYNLQTDDQTPVVYVRHNDGVTIDGFDIDAGGE
VGSYATEAHNYTVSDVTVTNASTGLWSDLSHIGHVVEDSYIEADETGVFYYWAADDGLIQ
NNTITGADTGIMTDHVSSGHDVVDNEIYDVGTGMLIDTDDGETDRNVITDADVGIQLGVS
GNVESVDDNHIENASVGLDEGSVNMPPEVHHNYFDSEVGVIDGDWNGPPSYYLNDFSESD
TVIETDQRIDVRMNYLGERDGQEPIADGPTDYSPHLTSPPSVEEGMDTTEIGYHLQVEAN
ESYGIGLPGPSEQTIGEIVPANFEGAIYGFDADEQEWKMKSGDDSVDTLAALVVVSESDA
KLDFNFQSDDDNPSAPGQHEFEEGWNYVTAPAHLDAESAFEIGSFEPEMIMSLQEAPGNQ
LGPEGELDRTHIFGDGDAGYVSPFEGYFVYSESDGTMPSQVAADPTAEEMFDELNISAHE
DHPETATIESVIETEGVSDKETEEALIALIKNDLMDEIEDANNSTEQFKALDDAAETIVS
DAPDEHETKVQNATSQSIELVIQAEFGQNIDVEHFDQVVDDEDEGAASSVSSPSLVTP
Download sequence
Identical sequences D3T2A8
WP_012996993.1.6702 WP_012996993.1.81346 gi|289937677|ref|YP_003482279.1| gi|289937677|ref|YP_003482279.1|NC_013924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]