SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3VQ23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3VQ23
Domain Number 1 Region: 10-266
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.51e-37
Family Epoxide hydrolase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3VQ23
Sequence length 273
Comment (tr|D3VQ23|D3VQ23_MYCAA) Esterase/lipase {ECO:0000313|EMBL:CBH40298.1} KW=Complete proteome OX=2110 OS=Mycoplasma agalactiae. GN=MAGa0650 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MQATVSIKNEQIHYIYEDAPEGTPVLLFIHGFKDRSKTIQPLLSIKDRNYSIYALDLPGC
GESSSNLGSYSIEFYAEVVREFINKVLPGKKVILMGHSMGAAVSLMCFDIANVKELVLVA
PFNYYAGLNADYEQGKRWMLPENIEDAVEAYKALVYNPNIFYIKGIQAFAMKDIQNKEKT
KAMFSYIVDNQFFNKSYLENVLKPLYQNAKKPYTLIYARNDLFTTEEEMLRLIEDIPTIT
PFAFEQCGHAVFFQKANKVNEIVSNLAQTLKAE
Download sequence
Identical sequences D3VQ23
gi|291319998|ref|YP_003515256.1| WP_013021728.1.24405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]