SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3YUT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3YUT7
Domain Number 1 Region: 8-199
Classification Level Classification E-value
Superfamily RUN domain-like 2.75e-35
Family RUN domain 0.00062
Further Details:      
 
Domain Number 2 Region: 593-661
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000314
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3YUT7
Sequence length 706
Comment (tr|D3YUT7|D3YUT7_MOUSE) Small G protein-signaling modulator 1 {ECO:0000313|Ensembl:ENSMUSP00000114932} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Sgsm1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MASVPAEAETRQRLLRTVKKEVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRR
AAGFLRSNKIAALFMKVGKGFPPAEELSRKVQELEQLIESARNQIQGLQENVRKLPKLPN
LSPLAIKHLWIRTALFERVLDKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCAL
EYTKMKTADHFWTDPSADELVQRHRIHSSHLRQDSPTKRPALCIQKRHSSGSMDDRPSIS
ARDYVESLHQNSRATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGS
VGDLDYEKSVYWDYAVTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLL
QFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSSESTSSDKEDDEATDYVFR
IIYPGTQSEFVALDLMGSPRPVSIGPAWMMLAAGQSMLVVAKGLQWAQTRGCLTIPTRSV
KEQPPMPQDLMDVSMNNLPPLWQPSPRKSSCSSCSQSGSADGGSTNGCNHERAPLKLLCD
NMKYQILSRAFYGWLAYCRHLSTVRTHLSALVNHMIVSPDLPCDAGQGLTASIWEKYIQD
STTYPEQELLRLIYYGGVQPEIRRAVWPFLLGHYQFGMTEMERKEVDEQIHACYAQTMSE
WLGCEAIVRQRERESHAAALAKCSSGASLDSHLHRMLHRDSTISNE
Download sequence
Identical sequences D3YUT7
ENSMUSP00000114932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]