SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3YW03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3YW03
Domain Number 1 Region: 195-373
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-44
Family Nuclear receptor ligand-binding domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 121-207
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.26e-30
Family Nuclear receptor 0.00000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3YW03
Sequence length 378
Comment (tr|D3YW03|D3YW03_MOUSE) Steroid hormone receptor ERR2 {ECO:0000313|Ensembl:ENSMUSP00000105832} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Esrrb OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MDVSELCIPDPLGYHNQLLNRMSSEDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSS
DASGGFGIALSTHANGLDSPPMFAGAGLGGNPCRKSYEDCTSGIMEDSAIKCEYMLNAIP
KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYNCPATNECEITKRRRKSCQACR
FMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSENSPYLNLPISPPAKKPLTKIVSNLLGV
EQDKLYAMPPNDIPEGDIKALTTLCELADRELVFLINWAKHIPGFPSLTLGDQMSLLQSA
WMEILILGIVYRSLPYDDKLAYAEDYIMDEEHSRLVGLLDLYRAILQLVRRYKKLKVEKE
EFMILKALALANSGKGGT
Download sequence
Identical sequences D3YW03
ENSMUSP00000105832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]