SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3YWJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3YWJ4
Domain Number 1 Region: 80-453
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.79e-131
Family Protein prenyltransferases 0.000000000000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3YWJ4
Sequence length 471
Comment (tr|D3YWJ4|D3YWJ4_MOUSE) Protein farnesyltransferase subunit beta {ECO:0000313|Ensembl:ENSMUSP00000120713} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Fntb OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MCGDCVEKEYPNRGTTCLENGSFLLNFAGCAVCSKRDFMLITNRSLKEEDGEEIVTYDHL
CKNCHHVVARHEYTFSIMDEFQAKVEEKIQEVFSSYKFNHLVPRLILQREKHFHYLKRGL
RQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPDGGFGGGPGQ
YPHLAPTYAAVNALCIIGTEEAYNVINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYC
AASVASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKKER
SLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMS
HWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDMV
MGVPENVLQPTHPVYNIGPEKVIQATTHFLQKPVPGFEECEDEVTSDPATD
Download sequence
Identical sequences D3YWJ4
ENSMUSP00000120713 ENSMUSP00000120713 ENSMUSP00000116906 10090.ENSMUSP00000120713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]