SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3YXQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3YXQ3
Domain Number 1 Region: 76-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.81e-17
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3YXQ3
Sequence length 173
Comment (tr|D3YXQ3|D3YXQ3_MOUSE) ATP-sensitive inward rectifier potassium channel 15 {ECO:0000313|Ensembl:ENSMUSP00000118992} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Kcnj15 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MVARWEKGSEDAPLTLQKIPDLQSGPKMDAIHLGMSSAPLVKHTNGVGLKAHRPRVMSKS
GHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVVYYAIAFIHG
DLQLGESNSNHTPCIMKVDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLL
Download sequence
Identical sequences D3YXQ3
ENSMUSP00000118992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]