SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3YYZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3YYZ1
Domain Number 1 Region: 92-126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 2 Region: 139-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000942
Family LDL receptor-like module 0.0052
Further Details:      
 
Weak hits

Sequence:  D3YYZ1
Domain Number - Region: 175-216
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000249
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3YYZ1
Sequence length 218
Comment (tr|D3YYZ1|D3YYZ1_MOUSE) Low density lipoprotein receptor class A domain-containing 1 {ECO:0000313|Ensembl:ENSMUSP00000092521} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Ldlrad1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSVGCERAEFCPACFWFLGQADAESNITTRRKARPGDEGCGPLCCSRRGACLSVGLLLLL
AMLAALLAVATILGHPPRTPETHSCVTLANRTGFLCHDRRHCIPAHAVCDGIRTCPHGED
EAESLCRDVPQSLPSFLLTTCGDPDSWIYSDQKCDGVNNCGDCSDELSPVTTCPPCGPGW
WRCSPTVFKYCSCVPRDLCRDSVQHCSDWSDEYSCPGP
Download sequence
Identical sequences D3YYZ1
ENSMUSP00000092521 10090.ENSMUSP00000092521 ENSMUSP00000092521 ENSMUSP00000092521 NP_001074741.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]