SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3Z1X9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D3Z1X9
Domain Number - Region: 30-100
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0222
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3Z1X9
Sequence length 105
Comment (tr|D3Z1X9|D3Z1X9_MOUSE) Transcription factor EB {ECO:0000313|Ensembl:ENSMUSP00000121888} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Tfeb OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MLLTLSGLSPLLSLQRAGLAASGYPFHREPEPTAAMASRIGLRMQLMREQAQQEEQRERM
QQQAVMHYMQQQQQQQQQLGGPPTPAINTPVHFQSPPPVPGEVLK
Download sequence
Identical sequences D3Z1X9
ENSMUSP00000121888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]