SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3Z3L3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3Z3L3
Domain Number 1 Region: 293-494
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-41
Family SPRY domain 0.0000566
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily RING/U-box 1.16e-23
Family RING finger domain, C3HC4 0.0076
Further Details:      
 
Domain Number 3 Region: 87-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.83e-17
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  D3Z3L3
Domain Number - Region: 119-240
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00235
Family Apolipoprotein A-I 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3Z3L3
Sequence length 497
Comment (tr|D3Z3L3|D3Z3L3_MOUSE) Tripartite motif-containing 12C {ECO:0000313|Ensembl:ENSMUSP00000116775} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Trim12c OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MASQFMKNLKEEVTCPLCLNLMVKPVSADCGHSFCQGCITVYFESTKCDKEMFSCPVCRL
SYQSSNLRPNLHVANIVERLKEFKPSPEEEQKVFNCARHGEKLQLFCRKDMMAICWLCER
SQEHRGHKTALIEEVAQEYKEQLQVVLQRLMADKKEFENWKDDLQKDRTYWENQIQKDVE
NVQSEFKRMRDIMNSEEKKELQKLKQEKENIINKLAESENEHAQQSKLLEDFISDVEHQL
QCSDIEILQGVENIIKRSHTFSMKKPKAIAREQRKFRAPDLQGMLQVLQEVTEAQRYWVQ
VTLVQNNNPNIAITDDKRQIRYEDLQARNLEHGCENSHEGVLGHPVIQSGKHYWEVDVSG
KGAWVLGLSDGSYLFNPIFRSNAERNPLFRRGIKNDSHYQPKYGFWVIGLWKKSVYNAFE
ECPFTGKPSVLTLSLMVPPCRVGVFLDYAAGTLSFYNISNNGTLIYRFCTASFPDRVFPY
FNPMGSSEPMTICWPDS
Download sequence
Identical sequences D3Z3L3
ENSMUSP00000060100 ENSMUSP00000060100 10090.ENSMUSP00000060100 NP_001139479.1.92730 NP_783608.3.92730 ENSMUSP00000060100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]