SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3Z9I5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3Z9I5
Domain Number 1 Region: 537-565,662-741
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000726
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3Z9I5
Sequence length 758
Comment (tr|D3Z9I5|D3Z9I5_RAT) Solute carrier family 26 member 6 {ECO:0000313|Ensembl:ENSRNOP00000027762} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_25530 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MGLPDGSDHGTQQTQALLSATQEMELERRDYHVERPLLNQEQLEDLGHWGPVSKTHPWRT
WFRCSRARAKSLLIQHVPVLGWLPRYPVREWLLGDLLSGLSVAIMQLPQGLAYALLAGLP
PMFGLYSSFYPVFVYFLFGTSRHISVGTFAVMSVMVGGVTESLTADEAFVQSLNTTVDGA
RVQVAYTLSFLVGLFQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVLVSQLKYVFGIKL
NSHSGPLSVIYTVLEVCAQLPKTVPGTVVTAIVAGVVLVLVKLLNEKLRRRLPLPIPGEL
LTLIGATAISYGVKLNDRFKVDVVGNITTGLIPPVAPKTELFATLVGNAFAIAVVGFAIA
ISLGKIFALRHGYRVDSNQELVALGLSNLIGGFFQCFPVSCSMSRSLVQESTGGNTQIAG
AVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQFSDICSLWKANRVDLLIWLV
TFVATILLNLDIGLAVSIVFSLLLVVIRMQLPHYSVLGQVPDTDIYRDVAEYSGAKEVPG
VKVFRSSATMYFANAELYSDSLKKKCGVDVDRLITQKKKRIKKQEMKIKRMNKAKKSQKQ
AASSKISSVSVNVNTNFEDIKSNDVEGSEAKVHQGEELEDVVASNQEDAKPPIMTSLKAL
GLPQPDFHSLILDLSTVSFVDTVCIKSLKNIFRDFREIEVEVYIAACYSPVVTQLEAGHF
FDESITKQHVFASVHDAVTFALHHRKSGPKSPVLATKL
Download sequence
Identical sequences D3Z9I5
10116.ENSRNOP00000027762 NP_001137289.1.100692 NP_001137289.1.4139 ENSRNOP00000027762 ENSRNOP00000027762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]