SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3ZB14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ZB14
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily DEATH domain 1.88e-23
Family Caspase recruitment domain, CARD 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3ZB14
Sequence length 165
Comment (tr|D3ZB14|D3ZB14_RAT) CASP2 and RIPK1 domain-containing adaptor with death domain {ECO:0000313|Ensembl:ENSRNOP00000062865} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_48999 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MDARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEIKAQTTGLRKTMLLLDI
LPSRGPKAFDTFLDSLQEFPWVREKLEKAREEATAELPTAQPRKDHLPEKPFIIRLITAA
PREAAPESLSPVAETAQSGQKGRLDQSNSCPSAPVAATEACLDQS
Download sequence
Identical sequences D3ZB14
ENSRNOP00000011424 10116.ENSRNOP00000062865 ENSRNOP00000062865 NP_001101555.1.100692 NP_001101555.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]