SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3ZD07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ZD07
Domain Number 1 Region: 3-226
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.18e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0045
Further Details:      
 
Domain Number 2 Region: 309-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.9e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3ZD07
Sequence length 543
Comment (tr|D3ZD07|D3ZD07_RAT) Flavin-containing monooxygenase {ECO:0000256|RuleBase:RU361177} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_46278 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MAKKRIAVIGAGISGLGAIKCCLDEDLEPTCFERSDDIGGLWKFQKNPSEKMPSIYKSVT
INTSKEMMCFSDFPIPDHFPNYMHNCKLMDYFRMYAEHFGLLDHIRFKTTVRSVRKRPDF
SVQGQWDVIVEADGKQESLVFDGILVCSGHHTDPHLPLKSFPGIEKFEGCYFHSREYKSP
EDYVGKRIIVVGIGNSGVDIAVELGRVAKQVFLSTRRGSWILHRVWNNGYPMDSSFFTRF
NSFLQKLLSTEAVNKYLEKMMNSRFNHAHYGLQPQHRPLSQHPTVSDDLPNHIISGKVQV
KPNVKEFRGTDVVFDDGTVEEKIDVVIFATGYSFSFPFLEDLIAVTDNEVSLYKLMFPPD
LEKPTLAVIGLIQPLGIVLPISELQSRWAVRVFKGLSKLPSVKIMNADMAQRKKAMAKRY
VKTVRHTIQVDHIEYMDEIAALAGVKPNLLLLFLSDPLLAMEVFFGPCTPYQYRLQGPGK
WDGARRAILTQRERIIKPLKTRITSEKSHSAPGLFWIKMTLFGLAFLVISLIYFSYICYE
KRK
Download sequence
Identical sequences D3ZD07
ENSRNOP00000036759 10116.ENSRNOP00000036759 ENSRNOP00000036759 NP_001102936.1.100692 NP_001102936.1.4139 XP_017454424.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]