SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3ZLC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ZLC7
Domain Number 1 Region: 484-830
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.14e-113
Family PDEase 0.00000026
Further Details:      
 
Domain Number 2 Region: 55-251
Classification Level Classification E-value
Superfamily GAF domain-like 7.85e-32
Family GAF domain 0.00039
Further Details:      
 
Domain Number 3 Region: 238-283,310-459
Classification Level Classification E-value
Superfamily GAF domain-like 6.28e-29
Family GAF domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3ZLC7
Sequence length 861
Comment (tr|D3ZLC7|D3ZLC7_RAT) Phosphodiesterase {ECO:0000256|RuleBase:RU363067} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_48218 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MGEISQDAVERYLEENPCFAKEYFDKKLRVETPGAIFKNSHAGVQAGTSLPRMTQVEESA
LCLELLQHMQDETGSAEQVAHRALQRLARLLQAECCSMFSCRSRNGIPEVASRLLNVTPT
SKFEDNLVAPNREVVFPLDIGIVGWVAHVKKALNVSNVKKNSHFSDFMDKQTGYVTRNLL
AVPIMTGKEVLAVVMAVNKINAPEFSKQDEEVFSKYLSFVAIALRLQHTSYLYSVESRRS
QILMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREIIFYKIIDYILHGKEEISVIPSPPADHWTLVSGLPTYIAENGFICN
MMNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEH
ITETLTQFLGWSLLNTDTYERVNKLESRKDIAQEMIMNLTKATPSEISSILKFKEKLNID
VIEECEERQLLAILKEELPDPRAADLYEFRFSDFPVTEHELVKCGLRLFLEINVVEKFKV
PVEVLTRWMYTVRKGYRPVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAF
CHDIDHRGTNNLYQMKSTSPLARLHGTSILERHHLEYSKTLLQDESLNIFQNLSKRQFET
VIHLFEVAIIATDLALYFKKRTMFQKIVDTCEQMQSEEETIKYVTADPTKKEVIMAMMMT
ACDLSAITKPWEVQSQATLLVANEFWEQGDLERTVLQQQPIPMMDRNKKGELPKLQVGFI
DFVCTFVYKEFSRFHGEITPMLTGLQNNRVEWKSLAEEYEAKVKVTEEEVGKQEEVTSDG
KAATDLGSSTDDKKSKTCLML
Download sequence
Identical sequences D3ZLC7
ENSRNOP00000022317 NP_001101992.1.100692 NP_001101992.1.4139 10116.ENSRNOP00000022317 ENSRNOP00000022317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]