SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3ZNQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ZNQ7
Domain Number 1 Region: 12-119
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.38e-18
Family Clostridium neurotoxins, the second last domain 0.089
Further Details:      
 
Domain Number 2 Region: 206-331,395-463
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000000153
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 1228-1295
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000153
Family Complement control module/SCR domain 0.005
Further Details:      
 
Domain Number 4 Region: 1159-1231
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000195
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 5 Region: 1046-1120
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000278
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Weak hits

Sequence:  D3ZNQ7
Domain Number - Region: 1128-1167
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000347
Family Complement control module/SCR domain 0.0054
Further Details:      
 
Domain Number - Region: 1366-1396
Classification Level Classification E-value
Superfamily Notch domain 0.0288
Family Notch domain 0.0048
Further Details:      
 
Domain Number - Region: 722-793
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0608
Family Fibronectin type III 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3ZNQ7
Sequence length 1440
Comment (tr|D3ZNQ7|D3ZNQ7_RAT) Pregnancy-associated plasma protein A (Predicted) {ECO:0000313|EMBL:EDM10508.1} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_55268 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MGIHTISDQGNRDPRYFFSLKTDRARKVTTIDAHRSYLPGQWVHLAATYDGRLMKLYMNG
AQVATSAEQVGGIFSPLTQKCKVLMLGGSALNHNFRGHIEHFSLWKVARTQREILSDMET
RGLHTPLPQLLLQENWDNVKRTWSPMKDGHSPQVEFSNAHGFLLDTNLEPPLCGQTLCDN
TEVISSYNQLPSFRQSKVVRYRVVNIYDDHHENPTVSWQQIDFQHQQLAEAFQHYNISWE
LDVLDINSSSLRHRLILANCDISKIGDEKCDPECNHTLTGHDGGDCRQLRYPAFMKKQQN
GACDMDCNYERFNFDGGECCDPDITDVTKTCFDPDSPHRAYLDVNELKNILKLDGSTHLN
IFFANSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGIPGHTHTMIHEIGHSLGLYHIF
RGISEIQSCSDPCMETEPSFETGDLCNDTNPAPKHKFCGDPGPGNDTCGFHGFFDTPYNN
FMSYADDDCTDSFTPNQVSRMHCYLDLVYQSWQPSRKPAPVALAPQIVGHTTDSVMLEWF
PPIDGHFFERELGSACDLCLEGRILVQYAFNASSPMPCGPSGHWSPREAEGHPDVEQPCK
SSVRTWSPNSAVNPHTVPPACPEPQGCYLELEFRYPLVPESLTIWVTFVSSDWDSSGAVN
DIKLLTVSGKNISLGPQNVFCDIPLTIRLRDVSEEVYGIQIYTLDEHLEIDAAMLTSAVD
SPLCLQCKPLQYKVLRDPPLLDDVGSLLHLNRRFMDMDLKLGNVYQYRIITISGNEESEP
SPAAIYTHGSGYCGDGVIQKDQGEECDDMNKVNGDGCSLFCKQEVSFNCIDEPSRCYFHD
GDGMCEEFEQKTSIKDCGVYTPQGFLDQWASNASVSHQDQQCPGWVVIGQPAASQVCRTK
VIDLSEGISQHAWYPCTINYPYYQLPQTTFWLQTYFSQPMVAAAVIIHLVTDGTYYGDQK
QETISLHVLSCRNNPLIIPVVHDLSQPFYHSQAVHVSFSSPLVAISGVALRSFDNFDPVT
LSSCQRGETYSPAEQSCVHFACEATDCPELTVENASLNCSSSHRYHGAQCTVSCQTGYVL
QIQRDDELIKSQVGPSVTVTCTEGKWNKQVACEPVDCGIPDHHHVYAASFSCPEGNNSFL
TCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSLCKYKCKPGYHVPGSS
RKSKKRAFKTQCTQDGSWQEGTCVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDA
SQGRGSNTIHCRKDGTWSGSFHVCREMQGQCSAPNQLNSHLKLQCPDGYAIGSECATSCL
DHNSESIILPVNLTVRDIPHWMNPTRVQRIVCTAGLQWYPHPARIHCVKGCEPFMGDNYC
DAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQDDCACRDPEAQEHSRKDLRGYSHG
Download sequence
Identical sequences D3ZNQ7
NP_001101409.1.100692 NP_001101409.1.4139 ENSRNOP00000046248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]