SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3ZQ68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ZQ68
Domain Number 1 Region: 36-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.66e-36
Family SCAN domain 0.0000376
Further Details:      
 
Domain Number 2 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 580-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.15e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 433-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-18
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 626-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.49e-18
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 6 Region: 375-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000161
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 213-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000105
Family KRAB domain (Kruppel-associated box) 0.0067
Further Details:      
 
Domain Number 8 Region: 526-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000152
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3ZQ68
Sequence length 680
Comment (tr|D3ZQ68|D3ZQ68_RAT) Zinc finger protein 263 {ECO:0000313|Ensembl:ENSRNOP00000010442} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Zfp263 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MSMAAGPSSQEPEGLLIVKLEEDCTWSQEVPPPEPEPSPEASHLRFRRFRFQDASGPREA
LNQLQELCRGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELRPESGEEAVTLVER
MQKELGKLRQQVTNQGRGAEVLLEEPLPLETAGESPSFKLEPMETERSPGPRLQELLDPS
PKRDSQAVKERALSAPWLSLFPPEGNVEDKDMTGTQLPESLEDMAMYISQEWDHQDHSKR
APSRDMVQDSYENVGTLESCIPSQEVSSTQVEQGGKPWDPSVQTCKEGMNPRNPVLGVEK
FENQERSVESVSPESTHPPVLLPGQARREVPWSPEQGRLDDREGHWECPPEDKIEESLMG
TPSCRGLVQAKEQPKKLHLCALCGKNFSNNSNLIRHQRIHAAEKLCMDVECGEVFGGHPH
FLSLHRTHVGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPFQCNVCGKSFSCNSNLNRH
QRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYRCSECGKSFSRSSHLVIHERTH
EKERLDPLPECGQGINDSAPFLTNHRVEKKLFECSTCGKSFRQGMHLTRHQRTHTGEKPY
KCILCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYKCSE
CGESFSRSSRLTSHQRTHTG
Download sequence
Identical sequences D3ZQ68
10116.ENSRNOP00000010442 XP_006245892.1.100692 ENSRNOP00000010442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]