SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3ZS55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ZS55
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000327
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3ZS55
Sequence length 264
Comment (tr|D3ZS55|D3ZS55_RAT) Somatomedin B and thrombospondin, type 1 domain-containing {ECO:0000313|Ensembl:ENSRNOP00000009530} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_30480 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MRTLWMVLCALARLWPGALAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACRLTG
DCCFDYDRACPARPCFVGEWSPWSGCAGQCQPTMRVRRRSVHQEPLNGGAPCPPLEERAG
CLEYSSSQGQDCGHSFVPAFITSSAFNKKRIVQAVSPQWPTHTEDAGYCMEFKTESLTAH
CALDSRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLRWQAIGNPRC
QGTWKKVRRAEQCSCPDVHRFIFI
Download sequence
Identical sequences D3ZS55
ENSRNOP00000009530 XP_001063197.2.4139 XP_216317.4.100692 ENSRNOP00000009530 10116.ENSRNOP00000009530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]